
El siguiente reglamento aplica al chat de la wiki, para las reglas del resto de la wiki ver Wiki Polanball:Normas y políticas, Al igualmente que están sujetas a la sección de Social y Reglas Generales establecidas en las normas y políticas
Estas son las normas por las que se rige en chat de Polanball. Estas son creadas por el bien de los usuarios de la enciclopedia, para evitar conflictos y posibles discusiones.

Es recomendable que los usuarios nuevos las lean. Para los usuarios mas veteranos de Wikia, a pesar de que estas no se diferencien demasiado a las que hay en el resto de las wikis, nunca está de más leerlas.

Acerca del Chat de Polandball

  • El chat de la wiki es vigilado por un admincrat, 2 administradores, 3 moderadores de chat, 1 mod. temporal de chat y un bot.
  • Cualquier duda acerca de un bloqueo debe de ser discutida con el moderador o administrador que lo aplicó.
  • Es recomendable que los administradores y moderadores del chat saquen capturas de pantalla como evidencia de faltas sancionadas.
  • Si algún usuario rompe alguna de las reglas del chat mientras no hay ningún moderador o administrador presente, puede sacar una captura de pantalla y denunciar el hecho posteriormente.
  • Al incumplir cualquiera de las siguientes reglas, el usuario sera baneado del chat y recibirá la sanción correspondiente.

Reglas del Chat 

  • 1.Queda prohibido insultar, discriminar o acosar a algún usuario en el chat de Polanball. Por incumplir esta regla, el usuario puede recibir un baneo del chat de un día a un mes, dependiendo de la gravedad del insulto y del número de veces que el usuario ha incumplido esta regla.
  • 2.Queda prohibido enviar enlaces a sitios pornográficos a través del chat. Por incumplir esta regla, el usuario puede recibir un bloqueo de un día a una semana de baneo en el chat, dependiendo del número de veces que el usuario ha incumplido esta regla.
  • 3.Queda prohibido hacer Spam en el chat. Por incumplir esta regla, el usuario recibirá dos llamadas de atención, y si vuelve a incumplir, recibirá una sanción de 1 a 5 días de baneo en el chat.. Ejemplo de spam en letritas:Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit
  • 4.Queda prohibido hacer Flood en el chat. Por incumplir esta regla, el usuario puede recibir un baneo de un día a una semana dependiendo de la gravedad del asunto. El flood es considerado una vez que te extiendes más de de 8 carácteres (al noveno se comienza a aplicar la norma correspondiente y sanciones designadas).
  • 5.Queda prohibido hacer comentarios racistas en el chat de la wiki. Por incumplir esta regla, el usuario puede recibir una sanción de un día a un mes de bloqueo en el chat. Esto incluye la xenofobia y homofobia; se puede hacer alegorías de estas índoles más no con fines de insulto a ningún tipo de usuario (Ni presentes o terceros). Si se hace se aplican las respectivas sanciones.
  • 6.Queda prohibido abusar de las mayúsculas. Por abuso de mayúsculas es poner más de tres renglones en mayúsculas (siempre y cuando las mayúsculas no sean para frases largas). Un ejemplo de algo permitido sería decir "AAAH", "QUE?" o "O POR DIOS" Por incumplir esta regla, el usuario podrá ser expulsado del chat y podrá recibir bloqueo por 1 a 8 días. De igual forma, por usarla continuamente cada vez que chateas, se está incumpliendo la regla y se sansiona por igual.
  • 7.No se permiten screamers.Enviar links de este tipo o pasar imágenes de estos por medio de chattags equivale a un baneo automático de una semana a un mes.
  • 8.No se permite gore.Imágenes de gore de cualquier tipo sea mostrado en links o chattags equivale a un baneo automático de una semana a un mes.
  • 9.Se pide discreción en cuanto datos personales.Los usuarios tienen permisos libres de expresar cosas de su vida personal, sin embargo todo usuario receptor no tiene permiso de revelar, divulgar o compartir esa información personal de los usuarios sin permiso de este. Esto incluye usuarios ajenos de este wiki y terceros. El usuario que no cumpla esta regla queda bloqueado un mes del wiki. Consulte acerca de información personal...
  • 10.Romper alguna de las reglas para ChatTags. Las sanciones por romperlas serán las que se establecen en la misma página, por favor leerlas para evitar problemas y confusiones.
  • 11.Hablar en otro idioma excesivamente no está permitido. Si el usuario no sabe español, se recomienda pedir ayuda de un traductor de internet o aprender español. Solo se permitirán algunos idiomas derivados de las lenguas romances (español en todas sus variantes, italiano, francés, portugués) e inglés. Otros idiomas y lenguajes deberán hablarse moderadamente y usar palabras populares, textos largos no pueden ser escritos en estos; igualmente, se recomienda no usar letras de otros idiomas (ruso, alemán, finés, japonés, chino, etc.); en caso de excederse un párrafo hablando otro idioma será expulsado, de volver a hacerlo, se le baneará por dos horas; si el usuario no quiere comprenderlo e insiste, se le banea por un día.
  • 12. No está permitido pegar la letra completa de una canción. Pegar una canción larga puede ser considerado spam, molesto y saturar el chat de información indeseada, por ello, se puede pegar párrafos de una canción en diferentes comentarios por el mismo usuario sin saturar el chat ni extenderse demasiado (O sea, sin escribir necesariamente toda la canción completa). Si se incumple esta regla se hace una expulsión, si se vuelve a hacer se banea un día al infractor de esta.
  • 13. Esta prohibido obligar a alguien cometer algo que no quiera o dar información que no quiera dar.Esto se aplica en dar información real, secretos u otro tipo de información; en otros actos, forzar a un usuario hacer algo que vaya en contra de sus derechos o no considere correcto para este o que atente contra el reglamento del wiki. Los administradores pueden solicitar información específica mas no usarla en contra del usuario, ni forzarlos a hacer algo en contra de este. Si se fuerza a un usuario a algo de esta índole el infractor queda baneado automáticamente por una semana. Consulte acerca de información personal...
  • 14. Quedan prohibidas las multicuentas para evadir baneos.Una vez descubierta una multicuenta de un usuario que halle sido baneado dentro del wiki, esta misma será bloqueada permanentemente dentro del wiki automáticamente. Recuerda, en caso de baneos y querer saber la razón de estos, puedes contactarte por medio del muro de mensajes del moderador de chat o administrador en lugar de usar una multicuenta.
  • 15. Cometer vandalismo dentro del chat está altamente prohibido. Quien lo cometa dentro del chat queda baneado un año.
  • 16.Se recomienda no hacer propaganda de otro wiki. No está permitido hacer propaganda de otra wiki enviando links de esta o link de su chat (esto no incluye a los aliados que tenemos exceptuando links de chat). Se puede enviar páginas de otro wiki solamente para lectura de esta y no para invitar a usuarios a unirse o colaborar. Si un usuario está interesado en decirle a otro de cualquier comunidad ajena a Polandball Wiki, se recomiendo hacerlo por medio de mensaje privado; si usted quiere propaganda para su wiki pida una alianza. Si se hace propaganda de manera indebida en chat público, se puede banear por un día o una semana.
  • 17.Causar peleas dentro del chat queda prohibido. Los infractores serán baneados 1 semana.
  • 18. Imponer ideologías o extremismo está prohibido.No se permite imponer a otros en creer o pensar en algo que les disguste. El usuario que rompa está regla será baneado de 1 día a un mes dependiendo de la gravedad de este.
  • 19. Queda prohibido incitar a banear o expulsar otro usuario.No se debe lanzar indirectas o usar cualquier cosa en contra de otro usuario a ser baneado o expulsado del chat sin justa razón. Quien haga esto será baneado 2 horas.
  • 20. No está permitido hacerse pasar por otros usuarios, cuentas o personas. Es decir, mencionar que tienes otras cuentas "desactivadas" cuando ni siquiera están registradas o hacerse pasar por algún famoso u otro usuario sin que nos diga que es él. El usuario que cometa esta puede considerarse multicuenta o mentiroso y se le dará un baneo de un año.
  • 21. No está permitido pasar multimedia "hipnóticas".Este tipo de imágenes, gifs o videos que tengan contenidos que puedan causar mareos, problemas en la visión, dolor de cabeza o hasta epilepsia, quedan prohibidos, ya que pueden dañar a los usuarios en su salud. Quien mande un tipo de multimedia relacionado a esto, será expulsado una primera vez, y luego baneado por una semana.
  • 22. Romper las reglas generales posee sanción.Algunas reglas generales poseen ya sus sanciones en este reglamento, sin embargo algunas no, es importante también que estas que no se encuentran sean sancionadas, todo dependerá de lo establecido en el reglamento general.
  • 23. Romper reglas en mensajes privados también puede ser sancionado.Si un usuario se siente agredido o incómodo al charlar con un usuario en mensaje privado dentro del chat, la primera solución es optar por bloquearle el permiso de enviarte un mensaje privado. Sin embargo, si sufres de acoso, amenazas o en privado rompe las reglas, tienes el permiso de anunciarlo a un administrador o moderador el cual tomará cartas en el asunto. Igualmente, la administración no es responsable de las charlas en privado entre usuarios, por ello solamente si se hace mediante aviso del usuario víctima se podrá tomar las acciones necesarias. Dependiendo de la regla que se rompa el usuario victimario tendrá su respectiva sanción.

Recuerda cumplir con estas normas para que la convivencia pacifica y amistosa en polanball wikia sea posible.

¡Interferencia de bloqueo de anuncios detectada!

Wikia es un sitio libre de uso que hace dinero de la publicidad. Contamos con una experiencia modificada para los visitantes que utilizan el bloqueo de anuncios

Wikia no es accesible si se han hecho aún más modificaciones. Si se quita el bloqueador de anuncios personalizado, la página cargará como se esperaba.